PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G21270.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 321aa    MW: 34607.3 Da    PI: 6.1845
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G21270.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.3e-18124178256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++keq   Le+ F+++++++ +++ +LA++l+L  rqV vWFqNrRa+ k
  OGLUM02G21270.3 124 RKKLRLSKEQSSFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQNRRARTK 178
                      788899***********************************************98 PP

2HD-ZIP_I/II126.41.3e-40124215192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      +kk+rlskeq+++LE+sF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL++ev+eLr +l+
  OGLUM02G21270.3 124 RKKLRLSKEQSSFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQNRRARTKLKQTEVDCEHLKRCCERLTRENRRLQREVAELRGALR 215
                      69**************************************************************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.6E-18105178IPR009057Homeodomain-like
SuperFamilySSF466898.77E-18115181IPR009057Homeodomain-like
PROSITE profilePS5007117.135120180IPR001356Homeobox domain
SMARTSM003892.1E-16122184IPR001356Homeobox domain
CDDcd000867.84E-17124181No hitNo description
PfamPF000461.1E-15124178IPR001356Homeobox domain
PROSITE patternPS000270155178IPR017970Homeobox, conserved site
SMARTSM003405.3E-19180224IPR003106Leucine zipper, homeobox-associated
PfamPF021835.0E-11180214IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGDEEDLELV LGVRATRRDE QDDQTTCTQS SEEAMEGEED ETRPHGEAPV ESLSFPLFVS  60
SAETGSANSE MCTRGFDVNT RPADGGAEAG RPSSPSSMQE ASTRQQVADQ EAADDEDNGG  120
GGARKKLRLS KEQSSFLEDS FKEHSTLTPK QKSDLANRLN LRPRQVEVWF QNRRARTKLK  180
QTEVDCEHLK RCCERLTREN RRLQREVAEL RGALRTTTSS YPPLYGLHHL PAAAGTVFRV  240
CPSCEHSKVV AAAASESFSP RVFACGGAPA AITAAAAVPS PGAGSPPSSS AALFGARRPH  300
FGPFAAAVIP PVLRRQPSAT S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172180RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0641180.0AK064118.1 Oryza sativa Japonica Group cDNA clone:002-102-B08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626186.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X2
RefseqXP_015626185.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X2
RefseqXP_015626184.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X2
RefseqXP_015626183.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X2
RefseqXP_015626182.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X2
RefseqXP_015626181.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X2
RefseqXP_015626180.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X2
RefseqXP_015626179.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X2
RefseqXP_015626177.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X2
RefseqXP_015626176.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X2
RefseqXP_015626175.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X2
RefseqXP_015626174.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X1
SwissprotA2X6740.0HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
TrEMBLA0A0D9YTU20.0A0A0D9YTU2_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9YTU30.0A0A0D9YTU3_9ORYZ; Uncharacterized protein
STRINGBGIOSGA006230-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-53homeobox from Arabidopsis thaliana